OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EEF1B2 (NM_001959) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321264L
Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 1 mg
Size:
1 mg 20 ug 100 ug
  $9,200.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375722 EEF1B2 Rabbit polyclonal Antibody
100 ul
$475.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EEF1B2 or NM_001959"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221264 representing NM_001959
Red=Cloning site Green=Tags(s)

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP
GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS
SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
EDYVQSMDVAAFNKI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Biolayer interferometry (BLI) assay (PMID: 26624286)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001950
Locus ID 1933
UniProt ID P24534
Cytogenetics 2q33.3
RefSeq Size 961
RefSeq ORF 675
Synonyms EEF1B; EEF1B1; EF1B
Summary This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
Li, Wei, Rawle et al
PLoS Pathog. (2015) 11 (12), e1005289 DOI: 10.1371/journal.ppat.1005289
Cited by 22
AI Summary: OriGene products, specifically full-length human eEF1A1, eEF1B2, eEF1G, and eEF1D proteins with C-terminal MYC/DDK tags, were used to study and characterize the interaction between eEF1A and HIV-1 reverse transcriptase in this research.
Snippet: Full-length human proteins expressed in HEK293 cells including eEF1A1, 1B2, 1G and 1D proteins having C-terminal MYC/DDK tags were purchased from OriGene (OriGene Technologies, MD, USA) and recombinant 6×His-tagged HIV-1 RT p51, RT p66, IN and Gag ... Cite SaveSaving
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products