FBP2 (NM_003837) Human Recombinant Protein

CAT#: TP321146M

Recombinant protein of human fructose-1,6-bisphosphatase 2 (FBP2), 100 µg

Product Images

Coomassie blue staining of purified FBP2 protein (Cat# TP321146). The protein was produced from HEK293T cells transfected with FBP2 cDNA clone (Cat# RC221146) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221146 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDE
  VKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIY
  RKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIY
  SLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLY
  ECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003828
• Locus ID: 8789
• UniProt ID: O00757
• Cytogenetics: 9q22.32
• Refseq Size: 1367
• Refseq ORF: 1017
• Summary: This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Pentose phosphate pathway