DEFB108B (NM_001002035) Human Recombinant Protein

CAT#: TP321032

Recombinant protein of human defensin, beta 108B (DEFB108B), 20 µg

Product Images

Coomassie blue staining of purified DEFB108B protein (Cat# TP321032). The protein was produced from HEK293T cells transfected with DEFB108B cDNA clone (Cat# RC221032) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221032 representing NM_001002035
  Red=Cloning site Green=Tags(s)
  
  MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP
  KKD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001002035
• Locus ID: 245911
• UniProt ID: Q8NET1
• Cytogenetics: 11q13.4
• Refseq Size: 222
• Refseq ORF: 219
• Synonyms: DEFB-8; hBD-8
• Summary: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. A pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein