CHI3L2 (NM_001025197) Human Recombinant Protein

CAT#: TP320858L

Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified CHI3L2 protein (Cat# TP320858). The protein was produced from HEK293T cells transfected with CHI3L2 cDNA clone (Cat# RC220858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220858 representing NM_001025197
  Red=Cloning site Green=Tags(s)
  
  MGATTMDQKSLWAGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVM
  LYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQK
  ENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEK
  PLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPG
  AAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIW
  SIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001020368
• Locus ID: 1117
• UniProt ID: Q15782
• Cytogenetics: 1p13.2
• Refseq Size: 1456
• Refseq ORF: 1140
• Synonyms: CHIL2; YKL-39; YKL39
• Summary: The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]