OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Osteocalcin (BGLAP) (NM_199173) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320555
Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA321966 Anti-BGLAP Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Osteocalcin or NM_199173"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220555 representing NM_199173
Red=Cloning site Green=Tags(s)

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
REVCELNPDCDELADHIGFQEAYRRFYGPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_954642
Locus ID 632
UniProt ID P02818
Cytogenetics 1q22
RefSeq Size 498
RefSeq ORF 300
Synonyms BGP; OC; OCN
Summary This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. provided by RefSeq, Jun 2015
Protein Categories Growth Factors, Secreated Proteins
Protein Families ES Cell Differentiation/IPS, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Osteocalcin" proteins (4)
SKU Description Size Price
PH320555 BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642) 10 ug
$3,360.00
LC404673 Lyophilized BGLAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404673 Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) (as WB positive control) 100 ug
$436.00
TP701039 Purified recombinant protein of Human bone gamma-carboxyglutamate (gla) protein (BGLAP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products