MRPL30 (NM_145213) Human Recombinant Protein
CAT#: TP320428
Recombinant protein of human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220428 protein sequence
Red=Cloning site Green=Tags(s) MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVT RIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLK STGELVVQWHLKPVEQKAHES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660214 |
Locus ID | 51263 |
UniProt ID | Q8TCC3 |
Cytogenetics | 2q11.2 |
Refseq Size | 1172 |
Refseq ORF | 483 |
Synonyms | FLJ44438; MGC3314; MGC24095; mitochondrial ribosomal protein L30; MRP-L28; MRPL28; OTTHUMP00000161222; RPML28 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene. [provided by RefSeq, Mar 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403434 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407915 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403434 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY407915 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH320428 | MRPL30 MS Standard C13 and N15-labeled recombinant protein (NP_660214) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review