OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Stathmin 1 (STMN1) (NM_203399) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320276
Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Stathmin 1 or NM_203399"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220276 protein sequence
Red=Cloning site Green=Tags(s)

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK
QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK
DPADETEAD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_981944
Locus ID 3925
UniProt ID P16949
Cytogenetics 1p36.11
RefSeq Size 1518
RefSeq ORF 447
Synonyms C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN
Summary This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2009
Protein Categories Cytokines, Growth Factors, Intracellular Proteins
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Stathmin 1" proteins (12)
SKU Description Size Price
PH305073 STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981946) 10 ug
$3,360.00
PH313958 STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_005554) 10 ug
$3,360.00
PH320276 STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944) 10 ug
$3,360.00
LC404338 Lyophilized STMN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404340 Lyophilized STMN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417225 Lyophilized STMN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404338 Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404340 Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY417225 Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305073 Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 1, 20 µg 20 ug
$737.00
TP313958 Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 3, 20 µg 20 ug
$737.00
TP720152 Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 4 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products