TTC9 (NM_015351) Human Recombinant Protein

CAT#: TP320249

Recombinant protein of human tetratricopeptide repeat domain 9 (TTC9), 20 µg

Product Images

Coomassie blue staining of purified TTC9 protein (Cat# TP320249). The protein was produced from HEK293T cells transfected with TTC9 cDNA clone (Cat# RC220249) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220249 representing NM_015351
  Red=Cloning site Green=Tags(s)
  
  MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKD
  KKFREAIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQ
  AELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMK
  LSRCSQREKEAM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056166
• Locus ID: 23508
• UniProt ID: Q92623, A0A024R6B1
• Cytogenetics: 14q24.2
• Refseq Size: 5217
• Refseq ORF: 666
• Synonyms: TTC9A
• Summary: This gene encodes a protein that contains three tetratricopeptide repeats. The gene has been shown to be hormonally regulated in breast cancer cells and may play a role in cancer cell invasion and metastasis. [provided by RefSeq, Mar 2009]