OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FGFR1 (NM_023106) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320009
Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FGFR1 or NM_023106"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220009 protein sequence
Red=Cloning site Green=Tags(s)

MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKM
EKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCI
VENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIG
PDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTS
PLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGV
LLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKV
AVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGL
EYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHI
DYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDK
PSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSG
EDSVFSHEPLPEEPCLPRHPAQLANGGLKRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 79.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_075594
Locus ID 2260
UniProt ID P11362
Cytogenetics 8p11.23
RefSeq Size 5644
RefSeq ORF 2193
Synonyms bFGF-R-1; BFGFR; CD331; CEK; ECCL; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Summary The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. provided by RefSeq, Jul 2008
Protein Categories Cancer: Gynecologic, CD Markers, Cytokines, Endocrine and metabolic diseases, Enzyme: Kinases, Growth Factors, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Adherens junction, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FGFR1" proteins (22)
SKU Description Size Price
PH302080 FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075598) 10 ug
$3,360.00
PH312579 FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075595) 10 ug
$3,360.00
PH314979 FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075596) 10 ug
$3,360.00
PH320009 FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075594) 10 ug
$3,360.00
LC402963 Lyophilized FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411517 Lyophilized FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411518 Lyophilized FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411519 Lyophilized FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414376 Lyophilized FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402963 Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY411517 Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY411518 Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY411519 Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY414376 Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP302080 Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, 20 µg 20 ug
$737.00
TP312579 Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 5, 20 µg 20 ug
$737.00
TP314979 Purified recombinant protein of Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 6, 20 µg 20 ug
$737.00
TP700118 Purified recombinant protein of Human fibroblast growth factor receptor 1, transcript variant 1, with C-terminal DDK/His tag, expressed in human cells 20 ug
$900.00
TP700119 Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP700120 Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP710005 Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1),residues 1-376 polyhistidine tag, expressed in sf9 cell 20 ug
$540.00
TP710236 Purified recombinant protein of Human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, residues 1-376aa, secretory expressed, with C-terminal HIS tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products