AMN (NM_030943) Human Recombinant Protein

CAT#: TP319248

Recombinant protein of human amnionless homolog (mouse) (AMN), 20 µg

Product Images

Coomassie blue staining of purified AMN protein (Cat# TP319248). The protein was produced from HEK293T cells transfected with AMN cDNA clone (Cat# RC219248) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219248 representing NM_030943
  Red=Cloning site Green=Tags(s)
  
  MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDML
  LPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHD
  DVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPEDCADPSG
  CVCGNAEAQPWICAALLQPLGGRCPQAACHFALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLG
  LPQYHGLQVAVSKVPRSSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG
  AHVWGSSAAGLAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
  LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112205
• Locus ID: 81693
• UniProt ID: Q9BXJ7
• Cytogenetics: 14q32.32
• Refseq Size: 1896
• Refseq ORF: 1359
• Synonyms: amnionless; IGS2; PRO1028
• Summary: The protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane