OTUD3 (NM_015207) Human Recombinant Protein

CAT#: TP318984

Recombinant protein of human OTU domain containing 3 (OTUD3), 20 µg

Product Images

Coomassie blue staining of purified OTUD3 protein (Cat# TP318984). The protein was produced from HEK293T cells transfected with OTUD3 cDNA clone (Cat# RC218984) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218984 representing NM_015207
  Red=Cloning site Green=Tags(s)
  
  MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGGGGGCEEEFVSFANQLQALGLKLREV
  PGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIV
  AFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDE
  SNKREKIKTKGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNA
  EENLEPSGRVLKQCGPLWEEGGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAKVTNKQRREQQ
  WMEKKKRQEERHRHKALESRGSHRDNNRSEAEANTQVTLVKTFAALNI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056022
• Locus ID: 23252
• UniProt ID: Q5T2D3
• Cytogenetics: 1p36.13
• Refseq Size: 6523
• Refseq ORF: 1194
• Synonyms: DUBA4
• Summary: Deubiquitinating enzyme that hydrolyzes 'Lys-6'- and 'Lys-11'-linked polyubiquitin. Also hydrolyzes heterotypic (mixed and branched) and homotypic chains.[UniProtKB/Swiss-Prot Function]