OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318982
Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Caspase 1 or NM_033294"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218982 representing NM_033294
Red=Cloning site Green=Tags(s)

MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTR
LALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLV
FMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIG
RLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_150636
Locus ID 834
UniProt ID P29466
Cytogenetics 11q22.3
RefSeq Size 941
RefSeq ORF 789
Synonyms ICE; IL1BC; P45
Summary This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. provided by RefSeq, Mar 2012
Protein Categories Cytokines, Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Protein Pathways Amyotrophic lateral sclerosis (ALS), Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Caspase 1" proteins (10)
SKU Description Size Price
PH318982 CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636) 10 ug
$3,360.00
LC409612 Lyophilized CASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409613 Lyophilized CASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420065 Lyophilized CASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409612 Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant gamma (as WB positive control) 100 ug
$436.00
LY409613 Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta (as WB positive control) 100 ug
$436.00
LY420065 Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant beta (as WB positive control) 100 ug
$436.00
TP760190 Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP761213 Purified recombinant protein of -Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00
TP762669 Purified recombinant protein of Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, 120Asn-297Asp, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products