OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EGFL7 (NM_016215) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318849
Purified recombinant protein of Homo sapiens EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA807863 EGFL7 mouse monoclonal antibody,clone OTI5C9 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EGFL7 or NM_016215"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218849 representing NM_016215
Red=Cloning site Green=Tags(s)

MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR
TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE
CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL
EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057299
Locus ID 51162
UniProt ID Q9UHF1
Cytogenetics 9q34.3
RefSeq Size 1569
RefSeq ORF 819
Synonyms NEU1; VE-STATIN; ZNEU1
Summary This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. provided by RefSeq, Feb 2012
Protein Categories Growth Factors, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EGFL7" proteins (6)
SKU Description Size Price
PH318849 EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) 10 ug
$3,360.00
LC402519 Lyophilized EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404428 Lyophilized EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402519 Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404428 Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP761665 Purified recombinant protein of Human EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products