OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAD51 (NM_002875) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318333
Recombinant protein of human RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RAD51 or NM_002875"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218333 representing NM_002875
Red=Cloning site Green=Tags(s)

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL
AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM
MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA
ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002866
Locus ID 5888
UniProt ID Q06609
Cytogenetics 15q15.1
RefSeq Size 2254
RefSeq ORF 1017
Synonyms BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Summary The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2009
Protein Categories Cancer: Gynecologic, Cardiovascular diseases, Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Homologous recombination, Pancreatic cancer, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAD51" proteins (11)
SKU Description Size Price
PH318333 RAD51 MS Standard C13 and N15-labeled recombinant protein (NP_002866) 10 ug
$3,360.00
LC408818 Lyophilized RAD51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419044 Lyophilized RAD51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429121 Lyophilized RAD51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431240 Lyophilized RAD51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431300 Lyophilized RAD51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408818 Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419044 Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY429121 Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431240 Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431300 Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products