OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD33 (NM_001082618) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317716L
Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 1 mg
Size:
1 mg 20 ug 100 ug
  $7,820.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506294 CD33 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CD33 or NM_001082618"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217716 representing NM_001082618
Red=Cloning site Green=Tags(s)

MPLLLLLPLLWADLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL
IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGV
TALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEE
LHYASLNFHGMNPSKDTSTEYSEVRTQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001076087
Locus ID 945
UniProt ID P20138
Cytogenetics 19q13.41
RefSeq Size 1085
RefSeq ORF 711
Synonyms p67; SIGLEC-3; SIGLEC3
Summary Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).UniProtKB/Swiss-Prot Function
Protein Categories ADC Targets, CAR-T Targets, CD Markers, Cytokines, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Evidence for C1q-mediated crosslinking of CD33/LAIR-1 inhibitory immunoreceptors and biological control of CD33/LAIR-1 expression
Son, Diamond, Volpe et al
Sci Rep (2017) 7 (1), 270 DOI: 10.1038/s41598-017-00290-w
AI Summary: OriGene contributed to this study by providing pcDNA plasmids encoding human CD33M (NM_001772), CD33m (NM_001082618), and control/empty vectors, which were used to transfect HEK293T cells for functional analysis of CD33 and LAIR-1 interactions.
Snippet: HEK293T cells (lacking CD33/ LAIR-1) were transfected using Lipofectamine 2000 (Invitrogen) for 24 hrs with control/empty pcDNA plasmid (Origene) or pcDNA plasmid containing either hu CD33M (NM_001772;Origene), hu CD33m (NM_001082618) or hu LAIR-1 (generously provided by John Coligan, National Institutes of Health, Bethesda, MD)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products