OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRIM58 (NM_015431) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317706
Recombinant protein of human tripartite motif-containing 58 (TRIM58), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA344502 Rabbit Polyclonal Anti-TRIM58 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TRIM58 or NM_015431"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217706 protein sequence
Red=Cloning site Green=Tags(s)

MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFR
PNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQ
VKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERA
TLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIP
GRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEV
LVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056246
Locus ID 25893
UniProt ID Q8NG06
Cytogenetics 1q44
RefSeq Size 2594
RefSeq ORF 1458
Synonyms BIA2
Summary E3 ubiquitin ligase induced during late erythropoiesis. Directly binds and ubiquitinates the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate in the erythroblast enucleation process through regulation of nuclear polarization.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRIM58" proteins (3)
SKU Description Size Price
PH317706 TRIM58 MS Standard C13 and N15-labeled recombinant protein (NP_056246) 10 ug
$3,360.00
LC402434 Lyophilized TRIM58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402434 Transient overexpression lysate of tripartite motif-containing 58 (TRIM58) (as WB positive control) 100 ug
$665.00

file-alt Citations

TRIM58 Restrains Intestinal Mucosal Inflammation by Negatively Regulating TLR2 in Myeloid Cells
Eyking, Ferber, Köhler et al
J. Immunol. (2019)
AI Summary: OriGene contributed to this study by providing recombinant human Myc-tagged TRIM58 protein and the Myc-tagged full-length TRIM58 (Myc-TRIM58-FL) in the pCMV6-entry vector, which were used to investigate TRIM58’s role in regulating TLR2 signaling in myeloid cells.
Snippet: control). Recombinant human Myc-tagged TRIM58 protein was obtained from OriGene InvivoGen. Human Myc- tagged full-length TRIM58 (Myc-TRIM58-FL) in the pCMV6-entry- tagged cloning vector (pCMV6) was obtained from OriGene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products