OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYTL2 (NM_206929) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317701
Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant e, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA360457 SYTL2 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SYTL2 or NM_206929"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217701 representing NM_206929
Red=Cloning site Green=Tags(s)

MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEV
KGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNE
ILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAEN
RGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKT
TNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWE
KMVNSPNTWIEATLPLRMLLIAKISK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_996812
Locus ID 54843
UniProt ID Q9HCH5
Cytogenetics 11q14.1
RefSeq Size 2447
RefSeq ORF 1128
Synonyms CHR11SYT; EXO4; PPP1R151; SGA72M; SLP2; SLP2A
Summary The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.provided by RefSeq, Jun 2009
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYTL2" proteins (13)
SKU Description Size Price
PH317584 SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_116561) 10 ug
$3,360.00
PH317701 SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812) 10 ug
$3,360.00
PH318076 SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755) 10 ug
$3,360.00
LC403206 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404177 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404178 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410172 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403206 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a (as WB positive control) 100 ug
$665.00
LY404177 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e (as WB positive control) 100 ug
$436.00
LY404178 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f (as WB positive control) 100 ug
$436.00
LY410172 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b (as WB positive control) 100 ug
$436.00
TP317584 Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant a, 20 µg 20 ug
$737.00
TP318076 Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant b, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products