OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTCP1 (NM_001018025) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317513
Recombinant protein of human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MTCP1 or NM_001018025"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217513 representing NM_001018025
Red=Cloning site Green=Tags(s)

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001018025
Locus ID 4515
UniProt ID P56278
Cytogenetics Xq28
RefSeq Size 1943
RefSeq ORF 321
Synonyms p8MTCP1; P13MTCP1; TCL1C
Summary This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. provided by RefSeq, Mar 2009
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTCP1" proteins (5)
SKU Description Size Price
PH317513 MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025) 10 ug
$3,360.00
LC415436 Lyophilized MTCP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422698 Lyophilized MTCP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415436 Transient overexpression lysate of mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1 (as WB positive control) 100 ug
$436.00
LY422698 Transient overexpression lysate of mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products