OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S6K1 (RPS6KB1) (NM_003161) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317324
Recombinant protein of human ribosomal protein S6 kinase, 70kDa, polypeptide 1 (RPS6KB1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502913 RPS6KB1 (S6K) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "S6K1 or NM_003161"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217324 representing NM_003161
Red=Cloning site Green=Tags(s)

MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE
KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT
KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH
QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG
ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP
FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG
EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity EMSA reaction (PMID: 27801893)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003152
Locus ID 6198
UniProt ID P23443
Cytogenetics 17q23.1
RefSeq Size 5332
RefSeq ORF 1575
Synonyms p70 S6KA; p70(S6K)-alpha; p70-alpha; p70-S6K; PS6K; S6K; S6K-beta-1; S6K1; STK14A
Summary This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. provided by RefSeq, Jan 2013
Protein Categories Enzyme: Kinases, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S6K1" proteins (3)
SKU Description Size Price
PH317324 RPS6KB1 MS Standard C13 and N15-labeled recombinant protein (NP_003152) 10 ug
$3,360.00
LC401097 Lyophilized RPS6KB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401097 Transient overexpression lysate of ribosomal protein S6 kinase, 70kDa, polypeptide 1 (RPS6KB1) (as WB positive control) 100 ug
$665.00

file-alt Citations

Activation of mTORC1 at late endosomes misdirects T cell fate decision in older individuals
Jin, Kim, Xia et al
Sci Immunol (2021) 6 (60) DOI: 10.1126/sciimmunol.abg0791
Cited by 53
AI Summary: OriGene’s S6K1 human recombinant protein (TP317324) was used as a substrate in mTORC1 kinase assays to assess mTORC1 activity in the study.
Snippet: One hundred nanograms of S6K1 human recombinant protein (TP317324, OriGene) diluted in 5 μl of mTORC1 kinase buffer was added as the substrate,
Tanc2-mediated mTOR inhibition balances mTORC1/2 signaling in the developing mouse brain and human neurons
Kim, Lee, Kim et al
Nat Commun (2021) 12 (1), 2695 DOI: 10.1038/s41467-021-22908-4
Cited by 37
AI Summary: OriGene’s recombinant mTOR protein (catalog #TP320457) was used in in vitro binding assays to demonstrate direct interaction between Tanc2 and mTOR in this study.
Snippet: … In vitro direct binding test GST, GST-Tanc2-N, GST-Tanc2-C, or GST-Tanc2 (full-length) proteins immobilized to agarose beads were incubated with the mTOR recombinant protein (0.5 µg;Origene #TP320457), or Deptor protein, in RIPA buffer for 2 h at 4 °C. Protein complexes in the agarose beads were washed with RIPA buffer three times and subjected to SDS-PAGE for Coomassie blue;GST-Tanc2 (full-length) proteins immobilized to agarose beads were incubated with the mTOR recombinant protein (0.5 µg;Origene #TP320457),
FigureFigureFigure
The DPYSL2 gene connects mTOR and schizophrenia
Pham, Song, Lao et al
Transl Psychiatry (2016) 6 (11), e933 DOI: 10.1038/tp.2016.204
AI Summary: OriGene products S6 (OriGene #TP317324) and ELAVL4 (OriGene #TP318612) were used as purified candidate binding proteins in RNA-protein interaction assays to investigate the molecular mechanisms linking the DPYSL2 gene, mTOR signaling, and schizophrenia.
Snippet: The radioactive RNA prob es for each of the two DNR alleles were hybridized to commercially purified candidate binding proteins: S6 48 (Origene #TP317324), 4EBP (NovoProtein #C200), eIF4E (MyBioSource #MBS203380), and ELAVL4 (Origene #TP318612)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products