OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JUND (NM_005354) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316958
Recombinant protein of human jun D proto-oncogene (JUND), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "JUND or NM_005354"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216958 representing NM_005354
Red=Cloning site Green=Tags(s)

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP
TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF
VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA
ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI
AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005345
Locus ID 3727
UniProt ID P17535
Cytogenetics 19p13.11
RefSeq Size 1891
RefSeq ORF 1041
Synonyms AP-1
Summary The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216). provided by RefSeq, Nov 2013
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JUND" proteins (3)
SKU Description Size Price
PH316958 JUND MS Standard C13 and N15-labeled recombinant protein (NP_005345) 10 ug
$3,360.00
LC417361 Lyophilized JUND HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417361 Transient overexpression lysate of jun D proto-oncogene (JUND) (as WB positive control) 100 ug
$436.00

file-alt Citations

Allelic effects on KLHL17 expression underlie a pancreatic cancer genome-wide association signal at chr1p36.33
Connelly, Hullin, Abdolalizadeh et al
Nat Commun (2025) 16 (1), 4055 DOI: 10.1038/s41467-025-59109-2
Cited by 2
AI Summary: OriGene products contributed to this study by providing recombinant proteins—ELF2 (TP760288), ELF3 (TP300631), ELF4 (TP761826), JUNB (TP303595), JUND (TP316958 4), c-FOS (TP760257), FOS1L (TP302104), FOSB (TP762032), and FOS2L (TP760114)—used in functional assays to investigate gene regulatory mechanisms underlying pancreatic cancer risk.
Snippet: ELF2 (TP760288), ELF3 (TP300631), ELF4 (TP761826), JUNB (TP303595), JUND (TP316958 4), c-FOS (TP760257), FOS1L (TP302104), FOSB (TP762032), FOS2L (TP760114) proteins were purchased from Origene (Rockville, MD). c-JUN was purchased from Abcam (Waltham, MA) (ab84134). ELF5, which has negligible expression in the pancreas, was not tested
FigureFigureFigure
Allelic effects on KLHL17 expression likely mediated by JunB/D underlie a PDAC GWAS signal at chr1p36.33
Connelly, Hullin, Abdolalizadeh et al
medRxiv (2024)
Snippet: ELF3 (TP300631), ELF4 (TP761826), JUNB (TP303595), JUND (TP316958 4), c-FOS (TP760257), FOS1L (TP302104), FOSB (TP762032), FOS2L (TP760114) protein were purchased from Origene (Rockville, MD). c-JUN was purchased from Abcam (Waltham, MA) (ab84134). ELF5, which has negligible expression in the pancreas, was not tested
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products