OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALGDS (NM_006266) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316933
Recombinant protein of human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380691 RALGDS Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RALGDS or NM_006266"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216933 representing NM_006266
Red=Cloning site Green=Tags(s)

MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEE
LINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYV
TIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSE
DFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPA
RAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLE
LEPAPAPVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQ
SNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGII
QGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAV
ERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSS
GDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVA
ATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIA
KGIF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 100.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006257
Locus ID 5900
UniProt ID Q12967
Cytogenetics 9q34.13-q34.2
RefSeq Size 3656
RefSeq ORF 2742
Synonyms RalGEF; RGDS; RGF
Summary Guanine nucleotide dissociation stimulators (GDSs, or exchange factors), such as RALGDS, are effectors of Ras-related GTPases (see MIM 190020) that participate in signaling for a variety of cellular processes.supplied by OMIM, Nov 2010
Protein Categories Intracellular Proteins
Protein Pathways Colorectal cancer, Pancreatic cancer, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALGDS" proteins (5)
SKU Description Size Price
PH316933 RALGDS MS Standard C13 and N15-labeled recombinant protein (NP_006257) 10 ug
$3,360.00
LC416759 Lyophilized RALGDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420857 Lyophilized RALGDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416759 Transient overexpression lysate of ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420857 Transient overexpression lysate of ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2 (as WB positive control) 100 ug
$665.00

file-alt Citations

The Functional Proximal Proteome of Oncogenic Ras Includes mTORC2
Kovalski, Bhaduri, Zehnder et al
Mol. Cell (2019) 73 (4), 830-844.e12 DOI: 10.1016/j.molcel.2018.12.001
AI Summary: In this study, OriGene’s recombinant proteins—including NRASQ61K (Cat# TP701004), NRAS (Cat# TP302681), MAPKAP1 (Cat# TP311745), mTOR (Cat# TP320457), KRASG12D (Cat# TP700052), HRASWT (Cat# TP316409), and custom-produced HRASG12V—were used to investigate and validate the interactions between oncogenic Ras proteins and mTORC2 components, elucidating key mechanisms in Ras-driven cancer proliferation.
Snippet: … They demonstrate that active Ras binds and stimulates mTORC2, representing a key dependency for Ras-driven proliferation genes and tumorigenesis. Cancer Ras Proteomics CRISPR mTOR MAPKAP1;... … They demonstrate that active Ras binds and stimulates mTORC2, representing a key dependency for Ras-driven proliferation genes and tumorigenesis. Cancer Ras Proteomics CRISPR mTOR MAPKAP1;NRASQ61K Human Recombinant Protein Origene Cat# TP701004 NRAS Human Recombinant Protein Origene Cat# TP302681 MAPKAP1 Human Recombinant Protein Origene Cat# TP311745 mTOR Human Recombinant Protein Origene Cat# TP320457 KRASG12D Human Recombinant Protein Origene Cat# TP700052 HRASWT Human Recombinant Protein Origene Cat# TP316409 HRASG12V Human Recombinant Protein Origene Custom Production from clone Cat# RC400129
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products