OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HIF1 beta (ARNT) (NM_001668) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316724
Recombinant protein of human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501147 ARNT (HIF1 beta) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HIF1 beta or NM_001668"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216724 representing NM_001668
Red=Cloning site Green=Tags(s)

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANL
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEI
YHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSN
PTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQS
NSYNNEEFPDLTMFPPFSE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 86.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001659
Locus ID 405
UniProt ID P27540
Cytogenetics 1q21.3
RefSeq Size 4846
RefSeq ORF 2367
Synonyms bHLHe2; HIF-1-beta; HIF-1beta; HIF1-beta; HIF1B; HIF1BETA; TANGO
Summary This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. provided by RefSeq, Oct 2013
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HIF1 beta" proteins (7)
SKU Description Size Price
PH316724 ARNT MS Standard C13 and N15-labeled recombinant protein (NP_001659) 10 ug
$3,360.00
PH317284 ARNT MS Standard C13 and N15-labeled recombinant protein (NP_848513) 10 ug
$3,360.00
LC400636 Lyophilized ARNT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405950 Lyophilized ARNT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400636 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY405950 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317284 Purified recombinant protein of Homo sapiens aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

The aryl hydrocarbon receptor interacts with c-Maf to promote the differentiation of type 1 regulatory T cells induced by IL-27
Apetoh, Quintana, Pot et al
Nat Immunol (2010) 11 (9), 854-61 DOI: 10.1038/ni.1912
Cited by 730
AI Summary: OriGene products contributed to this study by providing the c-Maf expression plasmid (RC211218) and c-Maf shRNA (TL313386), which were used to manipulate c-Maf levels and investigate its interaction with the aryl hydrocarbon receptor in the differentiation of type 1 regulatory T cells.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products