OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBX5 (NM_000192) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316520
Recombinant protein of human T-box 5 (TBX5), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TBX5 or NM_000192"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216520 representing NM_000192
Red=Cloning site Green=Tags(s)

MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV
GTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPD
SPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETA
FIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRA
LSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE
DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYS
HGVPRTLSPHQYHSVHGVGMVPEWSDNS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000183
Locus ID 6910
UniProt ID Q99593
Cytogenetics 12q24.21
RefSeq Size 3921
RefSeq ORF 1554
Synonyms HOS
Summary This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TBX5" proteins (5)
SKU Description Size Price
PH316520 TBX5 MS Standard C13 and N15-labeled recombinant protein (NP_000183) 10 ug
$3,360.00
LC400071 Lyophilized TBX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403620 Lyophilized TBX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400071 Transient overexpression lysate of T-box 5 (TBX5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403620 Transient overexpression lysate of T-box 5 (TBX5), transcript variant 4 (as WB positive control) 100 ug
$665.00

file-alt Citations

SNP located in an AluJb repeat downstream of TMCO1, rs4657473, is protective for POAG in African Americans
Verkuil, Danford, Pistilli et al
Br J Ophthalmol (2019)
AI Summary: OriGene’s purified recombinant human T-box 5 (TBX5) protein with C-terminal MYC/DDK tag (catalog number TP316520) was used in electrophoretic mobility shift assays to study protein-DNA interactions relevant to glaucoma risk in this study.
Snippet: EMSA was performed using Biotinylated oligonucleotide probes (online supplementary table 1) and purified recombinant protein of human T-box 5 (TBX5) with C-terminal MYC/DDK tag (Origene, Rockville, MD;TP316520) and the Odyssey Infrared EMSA kit (LiCor
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products