OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTNNBIP1 (NM_020248) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316082
Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349836 Rabbit Polyclonal Anti-CTNNBIP1 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CTNNBIP1 or NM_020248"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216082 representing NM_020248
Red=Cloning site Green=Tags(s)

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA
FSRSETEDRRQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064633
Locus ID 56998
UniProt ID Q9NSA3
Cytogenetics 1p36.22
RefSeq Size 2995
RefSeq ORF 243
Synonyms ICAT
Summary The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTNNBIP1" proteins (7)
SKU Description Size Price
PH312922 CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329) 10 ug
$3,360.00
PH316082 CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633) 10 ug
$3,360.00
LC412546 Lyophilized CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423325 Lyophilized CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412546 Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423325 Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312922 Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products