OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TXNRD1 (NM_182729) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316045
Recombinant protein of human thioredoxin reductase 1 (TXNRD1), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811366 TXNRD1 mouse monoclonal antibody,clone OTI7B2 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TXNRD1 or NM_182729"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216045 representing NM_182729
Red=Cloning site Green=Tags(s)

MNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLM
HQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRI
KATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEII
EGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAG
RLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNK
CYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGA
SILQAGCUG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_877393
Locus ID 7296
UniProt ID Q16881
Cytogenetics 12q23.3
RefSeq Size 3694
RefSeq ORF 1497
Synonyms GRIM-12; TR; TR1; TRXR1; TXNR
Summary The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis. provided by RefSeq, May 2017
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TXNRD1" proteins (3)
SKU Description Size Price
PH316045 TXNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_877393) 10 ug
$3,360.00
TP760704 Purified recombinant protein of Human thioredoxin reductase 1 (TXNRD1), transcript variant 1, (Note, selenocysteine protein, internal stop codon, see reference data summary), with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP761190 Purified recombinant protein of Human thioredoxin reductase 1 (TXNRD1), transcript variant 4, (Note, selenocysteine protein, internal stop codon, see reference data summary), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

Targeting thioredoxin reductase 1 by Andrographolide contributes to inducing ROS-mediated apoptosis in human NSCLC cells
Wang, Jin, Jin et al
Chem Biol Interact (2025) 421, 111778 DOI: 10.1016/j.cbi.2025.111778
AI Summary: OriGene’s recombinant human thioredoxin reductase 1 protein (Cat: TP316045) was used to assess TrxR1 enzymatic activity and its inhibition by Andrographolide in NSCLC cells, helping elucidate the compound’s mechanism of inducing ROS-mediated apoptosis.
Snippet: The TrxR1 activity was measured using DTNB assay. In 96-well plates, NADPH reduced TrxR1 (Zeye Biotechnology, Cat: ZY61722Hu01;Origene, Cat: TP316045) was incubated with Andro for 2 h. TE buffer (50 mM Tris-HCl, pH7.5, 1 mM EDTA, 50 μL) including DTNB and NADPH (2 mM and 200 μM, respectively). The absorbance was measured at 412 nm
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products