OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FGFR3 (NM_000142) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315533
Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA801078 FGFR3 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FGFR3 or NM_000142"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215533 representing NM_000142
Red=Cloning site Green=Tags(s)

MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG
PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE
AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ
WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD
AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH
SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE
AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK
GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV
MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV
EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY
SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

TRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 85.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000133
Locus ID 2261
UniProt ID P22607
Cytogenetics 4p16.3
RefSeq Size 4093
RefSeq ORF 2418
Synonyms ACH; CD333; CEK2; HSFGFR3EX; JTK4
Summary This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. provided by RefSeq, Aug 2017
Protein Categories Cancer: Bladder, Cancer: Haematopoietic and Lymphoid, CD Markers, Enzyme: Kinases, Growth Factors, Intracellular Proteins, Membrane Proteins, Secreated Proteins
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Bladder cancer, Endocytosis, MAPK signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FGFR3" proteins (7)
SKU Description Size Price
PH315533 FGFR3 MS Standard C13 and N15-labeled recombinant protein (NP_000133) 10 ug
$3,360.00
LC424902 Lyophilized FGFR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424902 Transient overexpression lysate of fibroblast growth factor receptor 3 (FGFR3), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP700122 Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP700123 Purified recombinant protein FGFR3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens fibroblast growth factor receptor 3, transcript variant 2, Signal peptide (1-22) plus EC domain (23-310) expressed in human cells, 20 µg 20 ug
$900.00
TP700124 Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP710033 Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), residues 23-375, with C-terminal DDK tag, expressed in sf9 cells. 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products