OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMPCB (NM_004279) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315039
Recombinant protein of human peptidase (mitochondrial processing) beta (PMPCB), nuclear gene encoding mitochondrial protein, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350292 Rabbit Polyclonal Anti-PMPCB Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PMPCB or NM_004279"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215039 representing NM_004279
Red=Cloning site Green=Tags(s)

MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVA
SEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTV
YYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRT
ILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFT
GSEIRVRDDKMPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSF
QSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICE
DIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004270
Locus ID 9512
UniProt ID O75439
Cytogenetics 7q22.1
RefSeq Size 1771
RefSeq ORF 1467
Synonyms Beta-MPP; MAS1; MPP11; MPPB; MPPP52; P-52
Summary This gene is a member of the peptidase M16 family and encodes a protein with a zinc-binding motif. This protein is located in the mitochondrial matrix and catalyzes the cleavage of the leader peptides of precursor proteins newly imported into the mitochondria, though it only functions as part of a heterodimeric complex. provided by RefSeq, Jul 2008
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMPCB" proteins (3)
SKU Description Size Price
PH315039 PMPCB MS Standard C13 and N15-labeled recombinant protein (NP_004270) 10 ug
$3,360.00
LC418095 Lyophilized PMPCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418095 Transient overexpression lysate of peptidase (mitochondrial processing) beta (PMPCB), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$665.00

file-alt Citations

A peptide derived from TID1S rescues frataxin deficiency and mitochondrial defects in FRDA cellular models
Dong, Ngaba, An et al
Front Pharmacol (2024) 15, 1352311 DOI: 10.3389/fphar.2024.1352311
Cited by 2
AI Summary: OriGene's human TID1L protein with a C-terminal Myc/DDK tag (Catalog #TP315039) was used in binding assays to investigate the interaction between TID1 and frataxin, contributing to the study's findings on the regulation of frataxin levels in Friedreich's ataxia models.
Snippet: … Louis, MO) or recombinant human frataxin fused to an N-terminal GST tag (GST-Frataxin) (Novus biologicals Littleton, CO) were bound to glutathione beads in RIPA buffer (100 mM Tris-HCL, 150 mM NaCl, 1% IGEPAL, 0.5% Sodium deoxycholate, 1 mM EDTA, pH 7.4) overnight at 4°C. After 4 washes, 2 μg human TID1L fused to a C-terminal Myc/DDK tag (Origene, Rockville, MD, Catalog #TP315039) was added and incubated overnight at 4°C. …
FigureFigureFigure
GRP75 overexpression rescues frataxin deficiency and mitochondrial phenotypes in Friedreich Ataxia cellular models
Dong, McMillian, Clark et al
Hum. Mol. Genet. (2018) 28 (10), 1594-1607 DOI: 10.1093/hmg/ddy448
AI Summary: In this study, the OriGene MPP-MYC/DDK plasmid (Catalog #TP315039) was used to express tagged mitochondrial processing peptidase, enabling investigation of its interaction with GRP75 and frataxin in the context of Friedreich Ataxia cellular models.
Snippet: …All rights reserved. For Permissions, please email: journals.permissions@oup.com 1;- mitochondrial processing peptidase (MPP) fused to a C-terminal MYC/DDK tag (MPP- MYC/DDK) (Origene, Rockville, MD, Catalog #TP315039) was added and incubated overnight at 4°C. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products