OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Thrombospondin 1 (THBS1) (NM_003246) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314802
Recombinant protein of human thrombospondin 1 (THBS1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA382495 THBS1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Thrombospondin 1 or NM_003246"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214802 protein sequence
Red=Cloning site Green=Tags(s)

MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPV
PDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHV
VSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQG
VLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSM
VLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKK
VSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACP
INGGWGPWSPWDICSVTCGGGVQKRSRLCNNPAPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGV
KCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPF
GQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPN
ENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDV
GDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNC
RLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVR
HQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGF
IRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 127.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003237
Locus ID 7057
UniProt ID P07996
Cytogenetics 15q14
RefSeq Size 5820
RefSeq ORF 3510
Synonyms THBS; THBS-1; TSP; TSP-1; TSP1
Summary The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Secreated Proteins
Protein Families Druggable Genome
Protein Pathways Bladder cancer, ECM-receptor interaction, Focal adhesion, p53 signaling pathway, TGF-beta signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Thrombospondin 1" proteins (3)
SKU Description Size Price
PH314802 THBS1 MS Standard C13 and N15-labeled recombinant protein (NP_003237) 10 ug
$3,360.00
LC401119 Lyophilized THBS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401119 Transient overexpression lysate of thrombospondin 1 (THBS1) (as WB positive control) 100 ug
$665.00

file-alt Citations

POSTN Promotes the Proliferation of Spermatogonial Cells by Activating the Wnt/β-Catenin Signaling Pathway
Li, Cheng, Xu et al
Reprod Sci (2021)
Cited by 13
AI Summary: OriGene’s recombinant THBS1 protein was used in this study to investigate its effects on spermatogonial cell proliferation alongside POSTN, contributing to the analysis of factors influencing the Wnt/β-catenin signaling pathway.
Snippet: Recombinant POSTN was obtained from Sino Biological (Beijing, China). Recombinant THBS1 was obtained from OriGene Technologies (Rockville, MD, USA). XAV939 was purchased from MedChemExpress (Shanghai, China). Ethical Approval
Identification of a novel natriuretic protein in patients with cerebral-renal salt wasting - implications for enhanced diagnosis
Maesaka, Imbriano, Pinkhasov et al
The American Journal of the Medical Sciences (2020)
Cited by 17
AI Summary: OriGene products, including kininogen, thrombospondin, PROZ, alpha 1 microglobulin/bikunin, retinol binding protein, and recombinant Hpr-WSP, were used as reference proteins to aid in the identification and characterization of a novel natriuretic protein in this study.
Snippet: … Kininogen, thrombospondin, PROZ, alpha 1 microglobulin/bikunin, retinol binding protein and recombinant Hpr-WSP were purchased from Origene Technologies, Inc., Rockville MD. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products