OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIC8 (RIC8B) (NM_018157) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314610
Recombinant protein of human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA344920 Rabbit Polyclonal Anti-RIC8B Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RIC8 or NM_018157"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214610 representing NM_018157
Red=Cloning site Green=Tags(s)

MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRKKLCEGIFKVLIKDIPTTCQVSCLEVL
RILSRDKKVLVPVTTKENMQILLRLAKLNELDDSLEKVSEFPVIVESLKCLCNIVFNSQMAQQLSLELNL
AAKLCNLLRKCKDRKFINDIKCFDLRLLFLLSLLHTDIRSQLRYELQGLPLLTQILESAFSIKWTDEYES
AIDHNGPPLSPQETDCAIEALKALFNVTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSN
AVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFME
KRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGV
KQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPKEELLKP
MGLKPDGTITPLEEALNQYSVIEETSSDTD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060627
Locus ID 55188
UniProt ID Q9NVN3
Cytogenetics 12q23.3
RefSeq Size 4989
RefSeq ORF 1560
Synonyms hSyn; RIC8
Summary Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIC8" proteins (4)
SKU Description Size Price
PH314610 RIC8B MS Standard C13 and N15-labeled recombinant protein (NP_060627) 10 ug
$3,360.00
LC413256 Lyophilized RIC8B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413256 Transient overexpression lysate of resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B) (as WB positive control) 100 ug
$665.00
TP762690 Purified recombinant protein of Human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products