OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHOSPHO1 (NM_178500) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314434M
Recombinant protein of human phosphatase, orphan 1 (PHOSPHO1), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358908 PHOSPHO1 Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PHOSPHO1 or NM_178500"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214434 protein sequence
Red=Cloning site Green=Tags(s)

MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNE
YMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHS
LFRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCP
MGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_848595
Locus ID 162466
UniProt ID Q8TCT1
Cytogenetics 17q21.32
RefSeq Size 2046
RefSeq ORF 801
Summary Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Glycerophospholipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Glycolytic flux control by drugging phosphoglycolate phosphatase
Jeanclos, Schlötzer, Hadamek et al
Nat Commun (2022) 13 (1), 6845 DOI: 10.1038/s41467-022-34228-2
Cited by 12
AI Summary: OriGene contributed phosphatase plasmids—specifically murine LHPP (MC211738), LPIN1 (MC204460), MDP1 (MR201315), and NANP/HDHD4 (MR203153)—which were used in this study to investigate the selectivity of the PGP inhibitor CP1 and to compare activities among related phosphatases.
Snippet: (CP3) were from ChemDiv. Compounds 1D, 1E and 1F were from Ambinter. Phosphatase plasmids and commercially available phosphatases The following phosphatase constructs (in pCMV6) were purchased from Origene: murine LHPP (NM_029609;catalog #MC211738), murine LPIN1, transcript variant 2 (NM_015763, #MC204460), murine MDP1 (NM_023397, #MR201315), murine NANP/HDHD4 (NM_026086, #MR203153), murine NT5
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products