OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313742
Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CTRP3 or NM_181435"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213742 representing NM_181435
Red=Cloning site Green=Tags(s)

MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDN
NTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGN
HGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIF
SSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNH
AVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_852100
Locus ID 114899
UniProt ID Q9BXJ4
Cytogenetics 5p13.2
RefSeq Size 3789
RefSeq ORF 957
Synonyms C1ATNF3; CORCS; CORS; CORS-26; CORS26; CTRP3
Protein Categories Cytokines, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTRP3" proteins (7)
SKU Description Size Price
PH311047 C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_112207) 10 ug
$3,360.00
PH313742 C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) 10 ug
$3,360.00
LC405756 Lyophilized C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410641 Lyophilized C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405756 Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410641 Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311047 Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products