OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAM9B (NM_205849) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313736
Recombinant protein of human family with sequence similarity 9, member B (FAM9B), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA309058 Rabbit polyclonal antibody to FAM9B (family with sequence similarity 9, member B)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FAM9B or NM_205849"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213736 representing NM_205849
Red=Cloning site Green=Tags(s)

MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM
KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK
WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_995321
Locus ID 171483
UniProt ID Q8IZU0
Cytogenetics Xp22.31
RefSeq Size 1339
RefSeq ORF 558
Synonyms TEX39B
Summary This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. provided by RefSeq, Aug 2011
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAM9B" proteins (3)
SKU Description Size Price
PH313736 FAM9B MS Standard C13 and N15-labeled recombinant protein (NP_995321) 10 ug
$3,360.00
LC404199 Lyophilized FAM9B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404199 Transient overexpression lysate of family with sequence similarity 9, member B (FAM9B) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products