OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLA2R (PLA2R1) (NM_001007267) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313576
Purified recombinant protein of Homo sapiens phospholipase A2 receptor 1, 180kDa (PLA2R1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA311382 Goat Anti-PLA2R1 Antibody
100 ug
$565.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PLA2R or NM_001007267"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213576 representing NM_001007267
Red=Cloning site Green=Tags(s)

MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKH
MLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVA
SRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRY
ERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIR
EHMSSKTVEVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTL
PYICKKYLNHIDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKV
KNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPPALVTITNRFEQAF
ITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEPVQYTHWNTHQPRYSGGCVAMRGRHPLGRWE
VKHCRHFKAMSLCKQPVENQEKAEYEERWPFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCE
EFGAHLASFAHIEEENFVNELLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGED
ARNCAVYKANKTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQ
SQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSS
WKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTSVWIGLQNDDYETWLNGKPVVYSNWSPFDII
NIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLE
YGNRTYKIINANMTWYAAIKTCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDG
TKSSFTFWKDEESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNSK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 150.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007268
Locus ID 22925
UniProt ID Q13018
Cytogenetics 2q24.2
RefSeq Size 5160
RefSeq ORF 3972
Synonyms CLEC13C; PLA2-R; PLA2G1R; PLA2IR; PLA2R
Summary This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.provided by RefSeq, Sep 2010
Protein Categories Cytokines, Membrane Proteins, Secreated Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLA2R" proteins (5)
SKU Description Size Price
PH313576 PLA2R1 MS Standard C13 and N15-labeled recombinant protein (NP_001007268) 10 ug
$3,360.00
LC423477 Lyophilized PLA2R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423477 Transient overexpression lysate of phospholipase A2 receptor 1, 180kDa (PLA2R1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP762670 Purified recombinant protein of Human phospholipase A2 receptor 1, 180kDa (PLA2R1), transcript variant 2, 385Tyr-643Cys, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00
TP790153 Purified recombinant protein of Human phospholipase A2 receptor 1(PLA2R1), transcript variant 1, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug 50 ug
$540.00

file-alt Citations

Diverse effects of phospholipase A2 receptor expression on LNCaP and PC-3 prostate cancer cell growth in vitro and in vivo
Friedemann, Nacke, Hagelgans et al
Oncotarget (2018) 9 (89), 35983-35996 DOI: 10.18632/oncotarget.26316
Snippet: To achieve siRNA-knockdown of PLA2R1 in PC-3 cells, three different siRNA duplexes containing PLA2R1 Trilencer-27 Human siRNA (# SR307882, OriGene Technologies, Inc., Rockville, MD, USA) were mixed in equal parts;To achieve siRNA-knockdown of PLA2R1 in PC-3 cells, three different siRNA duplexes containing PLA2R1 Trilencer-27 Human siRNA (# SR307882, OriGene Technologies, Inc., Rockville, MD, USA) were mixed in equal parts. …
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products