LOX (NM_002317) Human Recombinant Protein
SKU
TP313323
Recombinant protein of human lysyl oxidase (LOX), 20 µg
$867.00
5 Days*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC213323 representing NM_002317
Red=Cloning site Green=Tags(s) MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.8 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme activity (PMID: 25924936) In vivo treatment (PMID: 26017313) Cell treatment (PMID: 26077591) Binding assay (PMID: 26601954) In vivo treatment (PMID: 28445728) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002308 |
Locus ID | 4015 |
UniProt ID | P28300 |
Cytogenetics | 5q23.1 |
RefSeq Size | 1946 |
RefSeq ORF | 1251 |
Synonyms | AAT10 |
Summary | This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313323 | LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308) | 10 ug |
$3,255.00
|
|
LC400843 | LOX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400843 | Transient overexpression lysate of lysyl oxidase (LOX) | 100 ug |
$436.00
|
|
TP700002 | Recombinant protein of N-terminal propeptide (LOXPP) of human lysyl oxidase (LOX), with C-terminal DDK/His tag, expressed in human cells | 20 ug |
$867.00
|
|
TP790154 | Purified recombinant protein of Human lysyl oxidase (LOX), with C-terminal DDK tag, secretory expressed in CHO cells, 20ug | 20 ug |
$871.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.