OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Parathyroid hormone related protein (PTHLH) (NM_002820) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312858
Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA334682 Rabbit Polyclonal Anti-PTHLH Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Parathyroid hormone related protein or NM_002820"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212858 representing NM_002820
Red=Cloning site Green=Tags(s)

MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002811
Locus ID 5744
UniProt ID P12272
Cytogenetics 12p11.22
RefSeq Size 1881
RefSeq ORF 525
Synonyms BDE2; HHM; PLP; PTHR; PTHRP
Summary The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. provided by RefSeq, Nov 2013
Protein Categories Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Parathyroid hormone related protein" proteins (14)
SKU Description Size Price
PH312744 PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317) 10 ug
$3,360.00
PH312858 PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811) 10 ug
$3,360.00
LC401000 Lyophilized PTHLH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404641 Lyophilized PTHLH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404642 Lyophilized PTHLH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404643 Lyophilized PTHLH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430780 Lyophilized PTHLH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401000 Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404641 Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404642 Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404643 Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY430780 Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP312744 Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 20 µg 20 ug
$867.00
TP760737 Purified recombinant protein of Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products