OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GOLGA7 (NM_016099) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312483
Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA370460 GOLGA7 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GOLGA7 or NM_016099"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212483 protein sequence
Red=Cloning site Green=Tags(s)

MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL
ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057183
Locus ID 51125
UniProt ID Q7Z5G4
Cytogenetics 8p11.21
RefSeq Size 1919
RefSeq ORF 411
Synonyms GCP16; GOLGA3AP1; GOLGA7A; HSPC041
Summary May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GOLGA7" proteins (10)
SKU Description Size Price
PH304399 GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) 10 ug
$3,360.00
PH312483 GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_057183) 10 ug
$3,360.00
LC414189 Lyophilized GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424147 Lyophilized GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432569 Lyophilized GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414189 Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424147 Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432569 Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP304399 Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 2, 20 µg 20 ug
$867.00
TP329569 Purified recombinant protein of Homo sapiens golgin A7 (GOLGA7), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products