OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNG8 (NM_033258) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312301
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 8 (GNG8), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GNG8 or NM_033258"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212301 protein sequence
Red=Cloning site Green=Tags(s)

MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCVLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_150283
Locus ID 94235
UniProt ID Q9UK08
Cytogenetics 19q13.32
RefSeq Size 213
RefSeq ORF 210
Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNG8" proteins (3)
SKU Description Size Price
PH312301 GNG8 MS Standard C13 and N15-labeled recombinant protein (NP_150283) 10 ug
$3,360.00
LC409632 Lyophilized GNG8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409632 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 8 (GNG8) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products