OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TOX2 (NM_001098796) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311560
Recombinant protein of human TOX high mobility group box family member 2 (TOX2), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA329639 Rabbit Polyclonal anti-C20ORF100 antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TOX2 or NM_001098796"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211560 representing NM_001098796
Red=Cloning site Green=Tags(s)

MSDGNPELLSTSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQA
MDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGI
RSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSA
YALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKSS
PDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPP
PPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQLAMSPSPPGPQDFPHISEFPS
SSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001092266
Locus ID 84969
UniProt ID Q96NM4
Cytogenetics 20q13.12
RefSeq Size 2433
RefSeq ORF 1392
Synonyms C20orf100; dJ495O3.1; dJ1108D11.2; GCX-1; GCX1
Summary Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TOX2" proteins (9)
SKU Description Size Price
PH311560 TOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001092266) 10 ug
$3,360.00
LC409809 Lyophilized TOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420333 Lyophilized TOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420334 Lyophilized TOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420335 Lyophilized TOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409809 Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420333 Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY420334 Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY420335 Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 2 (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products