OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBL5 (NM_001048241) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311076
Recombinant protein of human ubiquitin-like 5 (UBL5), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA389631 UBL5 Rabbit pAb
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "UBL5 or NM_001048241"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211076 protein sequence
Red=Cloning site Green=Tags(s)

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL
YYQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001041706
Locus ID 59286
UniProt ID Q9BZL1
Cytogenetics 19p13.2
RefSeq Size 469
RefSeq ORF 219
Synonyms HUB1
Summary This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Jan 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBL5" proteins (7)
SKU Description Size Price
PH302790 UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_077268) 10 ug
$3,360.00
PH311076 UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_001041706) 10 ug
$3,360.00
LC402981 Lyophilized UBL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420793 Lyophilized UBL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402981 Transient overexpression lysate of ubiquitin-like 5 (UBL5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420793 Transient overexpression lysate of ubiquitin-like 5 (UBL5), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302790 Recombinant protein of human ubiquitin-like 5 (UBL5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products