OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL36 beta (IL36B) (NM_173178) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311037
Recombinant protein of human interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA326666 Rabbit Polyclonal IL-36B Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IL36 beta or NM_173178"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211037 protein sequence
Red=Cloning site Green=Tags(s)

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKD
LCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLT
KERGITNNTNFYLDSVE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775270
Locus ID 27177
UniProt ID Q9NZH7
Cytogenetics 2q14.1
RefSeq Size 1068
RefSeq ORF 471
Synonyms FIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Protein Categories Cytokines, Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL36 beta" proteins (3)
SKU Description Size Price
PH311037 IL1F8 MS Standard C13 and N15-labeled recombinant protein (NP_775270) 10 ug
$3,360.00
LC406635 Lyophilized IL36B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406635 Transient overexpression lysate of interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products