OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAX1 (NM_199131) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310985
Recombinant protein of human ventral anterior homeobox 1 (VAX1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA811439 VAX1 mouse monoclonal antibody,clone OTI4E5 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "VAX1 or NM_199131"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210985 protein sequence
Red=Cloning site Green=Tags(s)

MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAAD
PDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLS
ETQANSEENNERFKRGIKKQKKKRKKEPANDESRRGDSGGRGWQPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_954582
Locus ID 11023
UniProt ID Q5SQQ9
Cytogenetics 10q25.3
RefSeq Size 4494
RefSeq ORF 558
Synonyms MCOPS11
Summary This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAX1" proteins (5)
SKU Description Size Price
PH310985 VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582) 10 ug
$3,360.00
LC404744 Lyophilized VAX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426368 Lyophilized VAX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404744 Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426368 Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products