OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310892
Recombinant protein of human PPPDE peptidase domain containing 2 (PPPDE2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA339331 Rabbit Polyclonal Anti-D15Wsu75e Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PPPDE2 or NM_015704"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210892 protein sequence
Red=Cloning site Green=Tags(s)

MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDS
VVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPF
GQALRPLLDSIQIQPPGGSSVGRPNGQS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056519
Locus ID 27351
UniProt ID Q6ICB0
Cytogenetics 22q13.2
RefSeq Size 3804
RefSeq ORF 504
Synonyms D15Wsu75e; DeSI-1; DESI2; DJ347H13.4; FAM152B; POST; PPPDE2
Summary Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins. Has isopeptidase but not SUMO-processing activity (By similarity). Desumoylates ZBTB46 (By similarity). Collaborates with UBQLN4 in the export of ubiquitinated proteins from the nucleus to the cytoplasm (PubMed:29666234).UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPPDE2" proteins (3)
SKU Description Size Price
PH310892 PPPDE2 MS Standard C13 and N15-labeled recombinant protein (NP_056519) 10 ug
$3,360.00
LC414397 Lyophilized DESI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414397 Transient overexpression lysate of PPPDE peptidase domain containing 2 (PPPDE2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products