OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX11 (NM_013323) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310611
Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350439 Rabbit Polyclonal Anti-SNX11 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SNX11 or NM_013323"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210611 protein sequence
Red=Cloning site Green=Tags(s)

MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQL
QRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQ
GRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPV
VDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037455
Locus ID 29916
UniProt ID Q9Y5W9
Cytogenetics 17q21.32
RefSeq Size 2315
RefSeq ORF 810
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX11" proteins (7)
SKU Description Size Price
PH300906 SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_689450) 10 ug
$3,360.00
PH310611 SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_037455) 10 ug
$3,360.00
LC407675 Lyophilized SNX11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415626 Lyophilized SNX11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407675 Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY415626 Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300906 Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products