OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CACNB4 (NM_000726) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310440
Recombinant protein of human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA341725 Rabbit Polyclonal Anti-CACNB4 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CACNB4 or NM_000726"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210440 protein sequence
Red=Cloning site Green=Tags(s)

MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDR
EAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGR
LVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHI
PPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAII
ERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRG
KSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEE
DYPDSYQDTYKPHRNRGSPGGYSHDSRHRL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000717
Locus ID 785
UniProt ID O00305
Cytogenetics 2q23.3
RefSeq Size 7979
RefSeq ORF 1560
Synonyms CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6
Summary This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE), juvenile myoclonic epilepsy (JME), and episodic ataxia, type 5. provided by RefSeq, Aug 2016
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome, Ion Channels: Other
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CACNB4" proteins (9)
SKU Description Size Price
PH310440 CACNB4 MS Standard C13 and N15-labeled recombinant protein (NP_000717) 10 ug
$3,360.00
LC400240 Lyophilized CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423646 Lyophilized CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423647 Lyophilized CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429012 Lyophilized CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400240 Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423646 Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY423647 Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY429012 Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products