OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Phospholipase C beta 1 (PLCB1) (NM_015192) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310197
Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA327224 PLCB1 Rabbit Polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Phospholipase C beta 1 or NM_015192"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210197 protein sequence
Red=Cloning site Green=Tags(s)

MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVK
DARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATN
LLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPE
VYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEP
NNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYR
QVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTY
SDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKK
RNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMD
LAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVD
MFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPG
YHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTI
EELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEP
SSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQ
NNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKR
QEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDP
GKVNHKTPSSEELGGDIPGKEFDTPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 138.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056007
Locus ID 23236
UniProt ID Q9NQ66
Cytogenetics 20p12.3
RefSeq Size 7103
RefSeq ORF 3648
Synonyms DEE12; EIEE12; PI-PLC; PLC-154; PLC-beta-1; PLC-I; PLC154; PLCB1A; PLCB1B
Summary The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Calcium signaling pathway, Chemokine signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Inositol phosphate metabolism, Long-term depression, Long-term potentiation, Melanogenesis, Metabolic pathways, Phosphatidylinositol signaling system, Vascular smooth muscle contraction, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Phospholipase C beta 1" proteins (7)
SKU Description Size Price
PH310197 PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_056007) 10 ug
$3,360.00
PH316150 PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_877398) 10 ug
$3,360.00
LC405340 Lyophilized PLCB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414715 Lyophilized PLCB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405340 Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY414715 Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316150 Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products