OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310143
Recombinant protein of human mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA507147 MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Mannan Binding Lectin or NM_000242"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210143 protein sequence
Red=Cloning site Green=Tags(s)

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000233
Locus ID 4153
UniProt ID P11226
Cytogenetics 10q21.1
RefSeq Size 3569
RefSeq ORF 744
Synonyms COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Summary This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. provided by RefSeq, Jun 2020
Protein Categories Immune system diseases, Secreated Proteins
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Mannan Binding Lectin" proteins (3)
SKU Description Size Price
PH310143 MBL2 MS Standard C13 and N15-labeled recombinant protein (NP_000233) 10 ug
$3,360.00
LC424849 Lyophilized MBL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424849 Transient overexpression lysate of mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products