OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPL7L1 (NM_198486) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310095
Recombinant protein of human ribosomal protein L7-like 1 (RPL7L1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316328 Rabbit polyclonal anti-RPL7L1 antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RPL7L1 or NM_198486"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210095 protein sequence
Red=Cloning site Green=Tags(s)

MAEQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQKRDKVRLR
RLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTW
GFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFH
LSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_940888
Locus ID 285855
UniProt ID Q6DKI1
Cytogenetics 6p21.1
RefSeq Size 1293
RefSeq ORF 738
Synonyms dJ475N16.4
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPL7L1" proteins (3)
SKU Description Size Price
PH310095 RPL7L1 MS Standard C13 and N15-labeled recombinant protein (NP_940888) 10 ug
$3,360.00
LC404920 Lyophilized RPL7L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404920 Transient overexpression lysate of ribosomal protein L7-like 1 (RPL7L1) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products