OriGene Logo

CDK5RAP3 (NM_176096) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309901
Recombinant protein of human CDK5 regulatory subunit associated protein 3 (CDK5RAP3), 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349785 Rabbit Polyclonal Anti-CDK5RAP3 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CDK5RAP3 or NM_176096"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209901 protein sequence
Red=Cloning site Green=Tags(s)

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLR
ILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQ
QEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQA
SVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEG
TDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETR
NQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADI
SKRYSGRPVNLMGTSL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_788276
Locus ID 80279
UniProt ID Q96JB5
Cytogenetics 17q21.32
RefSeq Size 1996
RefSeq ORF 1518
Synonyms C53; HSF-27; IC53; LZAP; MST016; OK/SW-cl.114; PP1553
Summary This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. provided by RefSeq, May 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CDK5RAP3" proteins (3)
SKU Description Size Price
PH309901 CDK5RAP3 MS Standard C13 and N15-labeled recombinant protein (NP_788276) 10 ug
$3,360.00
LC406179 CDK5RAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406179 Transient overexpression lysate of CDK5 regulatory subunit associated protein 3 (CDK5RAP3) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.