OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TINAGL1 (NM_022164) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309508
Recombinant protein of human tubulointerstitial nephritis antigen-like 1 (TINAGL1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA344687 Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TINAGL1 or NM_022164"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209508 protein sequence
Red=Cloning site Green=Tags(s)

MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI
CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC
LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS
EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW
FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND
KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY
WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071447
Locus ID 64129
UniProt ID Q9GZM7
Cytogenetics 1p35.2
RefSeq Size 2252
RefSeq ORF 1401
Synonyms ARG1; LCN7; LIECG3; TINAGRP
Summary The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2011
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Protease, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TINAGL1" proteins (4)
SKU Description Size Price
PH309508 TINAGL1 MS Standard C13 and N15-labeled recombinant protein (NP_071447) 10 ug
$3,360.00
LC411719 Lyophilized TINAGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411719 Transient overexpression lysate of tubulointerstitial nephritis antigen-like 1 (TINAGL1) (as WB positive control) 100 ug
$436.00
TP721053 Purified recombinant protein of Human tubulointerstitial nephritis antigen-like 1 (TINAGL1), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products