OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKR1C2 (NM_205845) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309081
Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA313748 Rabbit polyclonal anti-AKR1C2 antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "AKR1C2 or NM_205845"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209081 protein sequence
Red=Cloning site Green=Tags(s)

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIA
DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD
TVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_995317
Locus ID 1646
UniProt ID P52895
Cytogenetics 10p15.1
RefSeq Size 3521
RefSeq ORF 969
Synonyms AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD
Summary This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. provided by RefSeq, Dec 2011
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Metabolism of xenobiotics by cytochrome P450
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AKR1C2" proteins (10)
SKU Description Size Price
PH309081 AKR1C2 MS Standard C13 and N15-labeled recombinant protein (NP_995317) 10 ug
$3,360.00
PH313538 AKR1C2 MS Standard C13 and N15-labeled recombinant protein (NP_001345) 10 ug
$3,360.00
LC400539 Lyophilized AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404270 Lyophilized AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427603 Lyophilized AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400539 Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404270 Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427603 Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP313538 Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 1, 20 µg 20 ug
$737.00
TP720265 Recombinant protein of human similar to hCG2017792 (LOC100134257) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products